anti psyk 2715 antibodies Search Results


anti chd6  (Bethyl)
93
Bethyl anti chd6
(A) Pulldown immunoprecipitation (IP) results demonstrating interactions between ZZEF1 domains and mononucleosomes. In, input. IP, biotin pulldown. His, anti-His-tag western blot. (B) Dot plot showing <t>CHD6</t> as a top interactor identified through ZZEF1 co-IP/MS. (C) Normalized ChIP-seq tracks showing enriched CHD6 binding (orange) in the proximal regions of tRNA-Lys-TTT-3 loci using a CHD6-specific antibody, compared to an IgG control in MDA cells. The purple tracks represent ZZEF1 binding from . (D) Normalized ATAC-seq tracks showing chromatin accessibility at tRNA-Lys-TTT-3 loci in MDA cells with ZZEF1 knockdown, CHD6 knockdown, and CHD6 knockdown in a ZZEF1-deficient background, compared to control cells. (E) Boxplot showing statistical analysis of chromatin accessibility from ATAC-seq at the tRNA-Lys-TTT-3 loci and non-target loci in ZZEF1 knockdown, CHD6 knockdown, and CHD6 knockdown in a ZZEF1-deficient background compared to control cells.
Anti Chd6, supplied by Bethyl, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/anti+psyk+2715+antibodies/bio_rxiv__2025__04__26__650725-312-15-16?v=Bethyl
Average 93 stars, based on 1 article reviews
anti chd6 - by Bioz Stars, 2026-08
93/100 stars
  Buy from Supplier
rabbit polyclonal anti gapdh antibody  (Biosynth Carbosynth)
90
Biosynth Carbosynth rabbit polyclonal anti gapdh antibody
(A) Pulldown immunoprecipitation (IP) results demonstrating interactions between ZZEF1 domains and mononucleosomes. In, input. IP, biotin pulldown. His, anti-His-tag western blot. (B) Dot plot showing <t>CHD6</t> as a top interactor identified through ZZEF1 co-IP/MS. (C) Normalized ChIP-seq tracks showing enriched CHD6 binding (orange) in the proximal regions of tRNA-Lys-TTT-3 loci using a CHD6-specific antibody, compared to an IgG control in MDA cells. The purple tracks represent ZZEF1 binding from . (D) Normalized ATAC-seq tracks showing chromatin accessibility at tRNA-Lys-TTT-3 loci in MDA cells with ZZEF1 knockdown, CHD6 knockdown, and CHD6 knockdown in a ZZEF1-deficient background, compared to control cells. (E) Boxplot showing statistical analysis of chromatin accessibility from ATAC-seq at the tRNA-Lys-TTT-3 loci and non-target loci in ZZEF1 knockdown, CHD6 knockdown, and CHD6 knockdown in a ZZEF1-deficient background compared to control cells.
Rabbit Polyclonal Anti Gapdh Antibody, supplied by Biosynth Carbosynth, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/anti+psyk+2715+antibodies/10__1172_slash_jci64416-273-35-31?v=Biosynth+Carbosynth
Average 90 stars, based on 1 article reviews
rabbit polyclonal anti gapdh antibody - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier
anti gapdh  (Biosynth Carbosynth)
86
Biosynth Carbosynth anti gapdh
(A) Pulldown immunoprecipitation (IP) results demonstrating interactions between ZZEF1 domains and mononucleosomes. In, input. IP, biotin pulldown. His, anti-His-tag western blot. (B) Dot plot showing <t>CHD6</t> as a top interactor identified through ZZEF1 co-IP/MS. (C) Normalized ChIP-seq tracks showing enriched CHD6 binding (orange) in the proximal regions of tRNA-Lys-TTT-3 loci using a CHD6-specific antibody, compared to an IgG control in MDA cells. The purple tracks represent ZZEF1 binding from . (D) Normalized ATAC-seq tracks showing chromatin accessibility at tRNA-Lys-TTT-3 loci in MDA cells with ZZEF1 knockdown, CHD6 knockdown, and CHD6 knockdown in a ZZEF1-deficient background, compared to control cells. (E) Boxplot showing statistical analysis of chromatin accessibility from ATAC-seq at the tRNA-Lys-TTT-3 loci and non-target loci in ZZEF1 knockdown, CHD6 knockdown, and CHD6 knockdown in a ZZEF1-deficient background compared to control cells.
Anti Gapdh, supplied by Biosynth Carbosynth, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/anti+psyk+2715+antibodies/pm26463278-85-24-4?v=Biosynth+Carbosynth
Average 86 stars, based on 1 article reviews
anti gapdh - by Bioz Stars, 2026-08
86/100 stars
  Buy from Supplier
prpf3 rabbit polyclonal antibody  (OriGene)
N/A
Rabbit anti PRPF3 Polyclonal Antibody
   Buy from Supplier
annexin a1 antibody anex 6e4 3 biotin  (Novus Biologicals)
N/A
The Annexin A1 Antibody ANEX 6E4 3 Biotin from Novus Biologicals is a mouse monoclonal antibody to Annexin A1 This antibody reacts with human The Annexin A1 Antibody ANEX 6E4 3 Biotin has been validated
   Buy from Supplier
annexin a1 antibody anex 6e4 3 fitc  (Novus Biologicals)
N/A
The Annexin A1 Antibody ANEX 6E4 3 FITC from Novus Biologicals is a mouse monoclonal antibody to Annexin A1 This antibody reacts with human The Annexin A1 Antibody ANEX 6E4 3 FITC has been validated
   Buy from Supplier
annexin a1 antibody anex 6e4 3 dylight 488  (Novus Biologicals)
N/A
The Annexin A1 Antibody ANEX 6E4 3 DyLight 488 from Novus Biologicals is a mouse monoclonal antibody to Annexin A1 This antibody reacts with human The Annexin A1 Antibody ANEX 6E4 3 DyLight 488 has
   Buy from Supplier
mdfi polyclonal antibody  (Elabscience)
N/A
This protein is a transcription factor that negatively regulates other myogenic family proteins Studies of the mouse homolog I mf show that it interferes with myogenic factor function by masking nuclear localization signals and preventing
   Buy from Supplier
hdac6 rabbit polyclonal antibody  (OriGene)
N/A
Rabbit anti HDAC6 Polyclonal Antibody
   Buy from Supplier
srp1 kpna1 rabbit polyclonal antibody  (OriGene)
N/A
Rabbit anti KPNA1 Polyclonal Antibody
   Buy from Supplier
human cadherin 6 kcad antibody  (R&D Systems)
N/A
The Human Cadherin 6 KCAD Antibody from R D Systems is a mouse monoclonal antibody to Cadherin 6 KCAD This antibody reacts with human The Human Cadherin 6 KCAD Antibody has been validated for the
   Buy from Supplier
prkrip1 antibody  (Biosynth Carbosynth)
N/A
PRKRIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPE. Rabbit polyclonal PRKRIP1 antibody.
   Buy from Supplier

Image Search Results


(A) Pulldown immunoprecipitation (IP) results demonstrating interactions between ZZEF1 domains and mononucleosomes. In, input. IP, biotin pulldown. His, anti-His-tag western blot. (B) Dot plot showing CHD6 as a top interactor identified through ZZEF1 co-IP/MS. (C) Normalized ChIP-seq tracks showing enriched CHD6 binding (orange) in the proximal regions of tRNA-Lys-TTT-3 loci using a CHD6-specific antibody, compared to an IgG control in MDA cells. The purple tracks represent ZZEF1 binding from . (D) Normalized ATAC-seq tracks showing chromatin accessibility at tRNA-Lys-TTT-3 loci in MDA cells with ZZEF1 knockdown, CHD6 knockdown, and CHD6 knockdown in a ZZEF1-deficient background, compared to control cells. (E) Boxplot showing statistical analysis of chromatin accessibility from ATAC-seq at the tRNA-Lys-TTT-3 loci and non-target loci in ZZEF1 knockdown, CHD6 knockdown, and CHD6 knockdown in a ZZEF1-deficient background compared to control cells.

Journal: bioRxiv

Article Title: Discovery of a tRNA-regulatory transcription factor that suppresses breast cancer metastasis

doi: 10.1101/2025.04.26.650725

Figure Lengend Snippet: (A) Pulldown immunoprecipitation (IP) results demonstrating interactions between ZZEF1 domains and mononucleosomes. In, input. IP, biotin pulldown. His, anti-His-tag western blot. (B) Dot plot showing CHD6 as a top interactor identified through ZZEF1 co-IP/MS. (C) Normalized ChIP-seq tracks showing enriched CHD6 binding (orange) in the proximal regions of tRNA-Lys-TTT-3 loci using a CHD6-specific antibody, compared to an IgG control in MDA cells. The purple tracks represent ZZEF1 binding from . (D) Normalized ATAC-seq tracks showing chromatin accessibility at tRNA-Lys-TTT-3 loci in MDA cells with ZZEF1 knockdown, CHD6 knockdown, and CHD6 knockdown in a ZZEF1-deficient background, compared to control cells. (E) Boxplot showing statistical analysis of chromatin accessibility from ATAC-seq at the tRNA-Lys-TTT-3 loci and non-target loci in ZZEF1 knockdown, CHD6 knockdown, and CHD6 knockdown in a ZZEF1-deficient background compared to control cells.

Article Snippet: 900 µL chromatin preparation was used for IP with 5 µg anti-ZZEF1 (Bethyl, A304-068A) or anti-CHD6 (Bethyl, A301-221A) at 4°C overnight.

Techniques: Immunoprecipitation, Western Blot, Co-Immunoprecipitation Assay, ChIP-sequencing, Binding Assay, Control, Knockdown